DPCstruct | MC35172
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 141 ± 12 aa |
| Standard deviation of domain lengths | 12.37 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 87.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 38.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0271 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2C6A5E0 | 1-137 | MSLDKIPDEIIQHLLYYISPSDNLESLQLVSRRLHRLASGHLLWRYHCRSSFRYWHQDHDFRHKLLRRVSDVDWKQLFIMRAERNRR… |
| A0A4R8SVP0 | 1-138 | MASLNQFPDEIILQILHYVPPDDILVSLQLSSRRLHRLANEPILWRQACAYSFDFWHPYHRFSKNVCRPSLETSWKTLFIIRRRRNI… |
| A0A370TDC8 | 634-793 | None |
| A0A428UF65 | 1-137 | None |
| A0A4R8Q6P0 | 1-138 | None |
| A0A238FD89 | 2-138 | None |
| H0ENB3 | 293-432 | None |
| A0A842Z4B8 | 1-161 | None |
| A0A4S9XF63 | 1-140 | None |
| A0A484FA80 | 1-138 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.