DPCstruct | MC35171
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 255 ± 57 aa |
| Standard deviation of domain lengths | 56.67 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 67.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.76 |
| Mean length-normalized TM-Score | 0.30 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 29.53 |
| Pfam Score | 94.35 |
| Assigned Pfam label(s) | CL0449- PF01805 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397VCP9 | 20-256 | QPGSTTTKETLTTPSLDSLSNFGTDNNTGETEISQLVPSTNQSTTPTLATNAQPISQQIYTTADKRKFVKYSDTYKPGMVRVGSKWV… |
| A0A7J7J4M6 | 8-168 | MYAYDSDEDTEGGTWEHKLRKKEMAATRDWADELTRQNRGKHHMGDFLPPDELKKFMETYQALKEGREPDLSDYKDFKITCENIGYK… |
| A0A1S3YFR2 | 127-344 | None |
| A0A7J6ZPJ2 | 638-939 | None |
| A0A7M7L3Q6 | 698-1016 | None |
| A0A369SAE5 | 148-457 | None |
| A0A6A5DI08 | 357-562 | None |
| A0A0D2MGG8 | 4-170 | None |
| A0A1X2I8V0 | 61-357 | None |
| A0A819VEE1 | 11-261 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.