DPCstruct | MC35170
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 110 ± 19 aa |
| Standard deviation of domain lengths | 19.15 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 78.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A397U2Z5 | 30-114 | NESSINTITLNTFGQAYNTPCLYTDPVTNIQCNGKPVLREYKKIDNTISTIRKFVGCKNYKLGQKGHHYISINQNVNLNYLEQLF |
| A0A397VAW1 | 1-126 | MRTCQGSKLCEFAANELYDQTHQCIDINSDLMMRITRKISSSNIDNNTLIKLYLAALETPCKFQKNQQLCEGKPVLRRLSCRNNSES… |
| A0A015NDB9 | 10-93 | None |
| A0A2N1M100 | 21-155 | None |
| A0A2I1GCD9 | 43-156 | None |
| A0A397IW67 | 305-414 | None |
| A0A2I1FDA1 | 13-91 | None |
| A0A397TT60 | 329-463 | None |
| A0A4V4HC27 | 382-473 | None |
| A0A2H5RPN2 | 70-152 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.