DPCstruct | MC3517
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 72 ± 8 aa |
| Standard deviation of domain lengths | 8.37 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 35.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4D6H935 | 1-73 | MLYRGNDGEYYGGVDIWERFESNSWTPFAWDPERGTEWVETDDQELLELTPVVREEVPRSVEIERTDSGLSVA |
| A0A1H7QUE5 | 1-70 | MNARYSCSDGQQYSEVEIWERLEDGIWRVCCWNSETGEEWMETDDGELVHLAPVPDEQSRQSTPSESTFN |
| L9VPN5 | 43-101 | None |
| A0A2R6LRX9 | 3-73 | None |
| L9WKJ7 | 84-167 | None |
| A0A6B0GX12 | 4-83 | None |
| A0A830FKS9 | 1-62 | None |
| A0A1H8VTM7 | 81-142 | None |
| A0A3N6PB93 | 12-92 | None |
| A0A1N7FL84 | 154-231 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.