DPCstruct | MC35169
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 126 ± 8 aa |
| Standard deviation of domain lengths | 8.37 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 82.34 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 49.77 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H5RLL7 | 145-272 | KKLGILEWMFNRMSIKPSSLEKIEKWQYQYNSIKVNDRNFYSKHLKIPGCVAIDARPCFMKFYPKAEKSSLAYYLKECELDNKLDMP… |
| A0A397V7H0 | 1-117 | MSPESSNIEEIKKWKCRKSEIKISDEKFYSNYLKIPEYIPIDVRVCFKKLYLKSEASSLKYYLEKCGLSSKADMPITTMNKIYKDAI… |
| A0A397TYB0 | 23-138 | None |
| A0A2N1NC92 | 262-402 | None |
| A0A397IM11 | 1-138 | None |
| A0A2Z6RLX4 | 56-183 | None |
| A0A2Z6Q5S3 | 38-152 | None |
| A0A397V4W9 | 181-312 | None |
| A0A2Z6Q9C4 | 357-484 | None |
| A0A397VM49 | 32-153 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.