DPCstruct | MC35160
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 328 ± 17 aa |
| Standard deviation of domain lengths | 17.31 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 77.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 21.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14735 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6B0RPB7 | 533-866 | PCNLSEEDLLQNPHFSQLLLSLSQHVDESGLSLTLAKEQAQAWKDVRLHKTTWLRSEILQRVIQELLVDYYVKTQDADLTSEDRKFH… |
| A0A397UNB6 | 1-340 | MPFQVNQSLLLANPNFARLYEQLTACYLNPDGTTKELSCNRNQDFYPADKLDYFENLVIYNAVKKLALQKDSRINKPADINEKTLEA… |
| A0A6G1FR26 | 1-301 | None |
| A0A094FH77 | 1-314 | None |
| S4RYS2 | 3-301 | None |
| A0A7J6D403 | 433-762 | None |
| A0A3S0Z8H3 | 21-356 | None |
| F7VQ31 | 1-346 | None |
| A0A084G068 | 1-353 | None |
| A0A3D8S7N9 | 1-322 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.