DPCstruct | MC35158
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 505 ± 84 aa |
| Standard deviation of domain lengths | 83.60 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 70.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 15.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10156 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2QKE0 | 24-553 | GVERYPSDSSYDEKRVSLIRRIDFAWALEDDEERERKKRQKKSSKDASATWQWQSMVENLQLAHQELSVIIDLINTVDANDAVTVAG… |
| A0A7C8N220 | 3-497 | ALDFVSLLLSNVRPTHAEASMSRHLKDTISSGTLGSDSVRKKDSTQAEKTDSEKISKGWRSESLVRSAGSLLNAASRLAQESEREQM… |
| H2APQ4 | 18-596 | None |
| A0A182F5C8 | 309-895 | None |
| A0A1D1W6Z2 | 30-642 | None |
| A0A4P9Y149 | 12-501 | None |
| A0A3M7MAV7 | 56-672 | None |
| A0A0G4LYS3 | 252-859 | None |
| R4XHR4 | 1-521 | None |
| F4PC77 | 190-699 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.