DPCstruct | MC35155
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 126 ± 21 aa |
| Standard deviation of domain lengths | 21.37 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 74.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.81 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 36.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A512D9R2 | 28-174 | LAVAAATVAIGGTAAIGAAARSGPGAGPRPDRWHAVTVNLAPQDVGSPGRWPQPIADLGDRVEVRVVPAPGDRGTELAVRARAGLRP… |
| A0A1I1QPY7 | 31-148 | ASTTEPADVAARRWRAVTVFRDDLAGPFPELEALGPDLEVRLQPAPGGRGTELYGRFHGTPGADRIGELRAALRRTKQLAEVGEVLR… |
| A0A853BSW2 | 2-161 | None |
| A0A837TPG0 | 1-120 | None |
| A0A8A9B080 | 10-109 | None |
| A0A3N5PDD1 | 125-237 | None |
| A0A2R4FPY2 | 7-97 | None |
| A0A1H6DA51 | 129-287 | None |
| A0A3A3Z3H3 | 15-172 | None |
| A0A1S8XQH9 | 80-217 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.