DPCstruct | MC3515
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 240 ± 38 aa |
| Standard deviation of domain lengths | 37.96 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 90.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 18.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y5PGI3 | 1-167 | MAHTHVGHALTAWPDTPGQKGLLDVARMEATVAAEHATYAVEGARNIASVKLHAGHVLHAVDPKLLPDGPGAGYGLTRALQGSAEHL… |
| A0A326U252 | 104-353 | LAQSNLLASYSRVLVTDEEGGMPTAPTLDSRLWRYEGAFPDTAGGQRFSALDHLRHLLAEEPTLKQLGLDGGFALYLQHNAARVDEW… |
| A0A535LTV7 | 20-284 | None |
| A0A402A644 | 453-730 | None |
| A0A535VKB9 | 233-484 | None |
| A0A7Y3J1I8 | 33-311 | None |
| A0A354NZA4 | 28-261 | None |
| A0A2G4IG28 | 134-325 | None |
| A0A5J4KW89 | 5-217 | None |
| A0A7I8ESV2 | 474-731 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.