DPCstruct | MC35145
Metacluster Properties and Pfam Annotations
| Number of structural domains | 91 |
|---|---|
| Mean domain length (aa) | 84 ± 9 aa |
| Standard deviation of domain lengths | 8.59 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 81.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 29.35 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G7ZFA3 | 12-93 | RRGKYAPLYRHLDQMRGDEWATTFRELEQILGFRLPNSARLYRPWWANDVKSGHSQSMAWSMAGWKTGNVDLDAETLEFRRD |
| A0A7C2WWE8 | 1-84 | MSIYAKLADILEAQAGDSWKVSFSELERLLDQKLPSSAFKYAGWWSNNPSNNAMTKIWLMAGWRTEKVDVPGQTVVFRRNKPPA |
| A0A4Y4B5K1 | 12-96 | None |
| A0A6L7YKN3 | 89-180 | None |
| A0A2N2KFY1 | 83-155 | None |
| A0A1L8QVE2 | 1-70 | None |
| A0A3A9A168 | 3-84 | None |
| A0A3B0BK23 | 2-75 | None |
| A0A497NYR0 | 5-76 | None |
| A0A413CYF8 | 1-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.