DPCstruct | MC35142
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 81 ± 10 aa |
| Standard deviation of domain lengths | 9.65 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 92.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.94 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 50.17 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X2PG94 | 156-232 | HASISCKWTIQSDSTKNARSEGLNLIWNRKSKPAQVAVVTGELLPSRISAIALGTDGIDCVYHFALPELLSAVEELG |
| A0A4P6EPI1 | 48-127 | EVGLSLKWSLRTDRAQDCRSQGAKMSALRRGRMPHFAVVTMEPRPYMLNLLGGGSGDVDCVYHLDLPALTTAVDAVYSTP |
| A0A2H5WZS4 | 132-232 | None |
| A0A7X0HFZ8 | 147-229 | None |
| A0A366WXI2 | 2-70 | None |
| A0A6L3AAZ7 | 202-280 | None |
| A0A100ZI89 | 25-100 | None |
| A0A101SY46 | 61-153 | None |
| A0A1Q4DB81 | 119-189 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.