DPCstruct | MC35141
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 187 ± 22 aa |
| Standard deviation of domain lengths | 22.41 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 19.57 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V9L0I5 | 28-238 | DGTIASVMKKEVLSKHRKALMLFGTFHLMHGPADDAVAVASYEKDYPNATFVIADLTFFRADLKGLPRNPFDAWPVPSLVLAKGTWL… |
| A0A3D3TGU2 | 341-530 | MADIIEQTIQSSADSRNSLFIVGYGHGYKSHVPGTFSTPPGQTPALSAGAQLVQRFSDHDIFSIFPHSPSMSNTRGSEGKLRNGLFD… |
| A0A6J4V4D8 | 17-178 | None |
| A0A4V2AES7 | 5-203 | None |
| A0A2V8YCP2 | 1-150 | None |
| A0A2V8IIA6 | 151-314 | None |
| A0A2V9ET66 | 214-432 | None |
| A4VBX4 | 1-216 | None |
| A0A812GIY1 | 2-155 | None |
| A0A0S8HHA3 | 313-493 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.