DPCstruct | MC3514
Metacluster Properties and Pfam Annotations
| Number of structural domains | 33 |
|---|---|
| Mean domain length (aa) | 105 ± 13 aa |
| Standard deviation of domain lengths | 13.18 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 88.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.59 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF14119 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A644XJK3 | 48-168 | YDKNVSPVGWYLVSYLLRFVELDDKEKNDDNARFLSWENSILVRATTMDEAYEKGVRMAREATKPYKGGPAGVLVQWKLVGVTDVLP… |
| A0A326TRS5 | 6-108 | WYVAEIIEEIRVEGEKENVVHRNFVLIQATSTEEAYQKALHYGKSYEATYENPEGQRVVSLFRGLGDLTQVLGEPQDGEEITYYRWI… |
| R7FDB7 | 2-102 | None |
| A0A1G9SWE2 | 2-106 | None |
| A0A1G9YPC5 | 4-98 | None |
| A0A7L7L675 | 125-230 | None |
| A0A542ZUZ9 | 7-108 | None |
| D5SU23 | 12-109 | None |
| A0A2V8KS85 | 1-114 | None |
| A0A5P2A190 | 51-157 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.