DPCstruct | MC35131
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 127 ± 13 aa |
| Standard deviation of domain lengths | 13.35 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 84.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 23.54 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y1TRL6 | 22-154 | FAQEDAATDAPERHRDYGVLWAKGEGHVELDVERAKLGMKVSGDVTIIGPSSLEVHIDGVRSNDLESNADIVIALDDFTGRIAIVGT… |
| A0A4Q3XV49 | 2-143 | KVQGPTPDSAVIDFHTKIGSFKILSNSQDVKARGKLDMEFQGTVLVIGLEGTATPNGALKVQYDDQTHGRKAFFGQGRLTVEGKWRA… |
| A0A7J4LLZ7 | 198-312 | None |
| A0A521WPD1 | 1-158 | None |
| A0A662RBZ7 | 294-428 | None |
| A0A1D2UYW1 | 304-418 | None |
| A0A0S7YCC3 | 13-143 | None |
| A0A497JAJ5 | 53-190 | None |
| A0A7Z9ZI28 | 20-143 | None |
| A0A662GWH9 | 27-132 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.