DPCstruct | MC35130
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 221 ± 26 aa |
| Standard deviation of domain lengths | 25.77 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 80.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 38.82 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7Y1TRI6 | 2-210 | EDLEIMKVNVAGGMADIAASQGLDLDSADLALGDDIEARYEGLWKELSNEVVIGEIERYRIREHVGRLNDLGFEVGDVELIPDEGGN… |
| A4BGN4 | 33-235 | DLELAHTNIAGDLMDLDASVGLPGQLDPIDLADSLLVRYENLWAELTRSDVFDPEDQYLIEKRIGRLNELGFDVEEMEITTVDNGKQ… |
| A0A1V5J881 | 11-259 | None |
| A0A318MQZ4 | 215-458 | None |
| A0A7W1D3B8 | 192-419 | None |
| A0A7W0WH14 | 1-168 | None |
| A0A2Z5QPR8 | 31-276 | None |
| A0A317GX18 | 252-487 | None |
| R6GAA5 | 2-251 | None |
| A0A7K1CJ95 | 3-185 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.