DPCstruct | MC3513
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 74 ± 5 aa |
| Standard deviation of domain lengths | 4.54 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 81.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 36.40 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1H9NKY2 | 1-78 | MAKLKVFGGLVQMGARGQCRTVVAATSQAKAAGALGCSLHELRAWWSVSGNKDDLAAALPNPGQVFMASSSMGRDFRP |
| A0A6I6MYQ4 | 1-74 | MAKLPPRIKVFRAQIGFGDWVVATSSKKLALEAWDVSRDLFATGEAEQTDDPKAITVAMTNIGKAVAMPRPKRR |
| N2J025 | 89-168 | None |
| A0A7G9L238 | 1-74 | None |
| A0A837CQV9 | 2-77 | None |
| K4N9Z0 | 64-142 | None |
| A0A7Y0I449 | 1-70 | None |
| A0A1I5V3J4 | 1-70 | None |
| A0A2W4X3C8 | 41-115 | None |
| A0A7W7P291 | 1-74 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.