DPCstruct | MC35128
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 249 ± 42 aa |
| Standard deviation of domain lengths | 42.19 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 79.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.38 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 14.50 |
| Pfam Score | 75.00 |
| Assigned Pfam label(s) | CL0287- PF13600 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V9QIU7 | 45-289 | LPVKRVVLYKNGVGYFEHSAHVRGNQDLGIDFTTGQLNDVLKSLTVVDLGEGRISGVRYNSTAPLDERLKALRLPFGEQVTRSDFLS… |
| A0A1F4C2Q7 | 1-243 | MYAAELPVRHVILYKHGIGYFERSGRLAPGESARLDFKASDMNDVLKSLTLTQKGGGAITGLRYDASEPLARKLDEFPFHIGERQPL… |
| A0A818LF06 | 7-208 | None |
| A0A3L7MX24 | 40-300 | None |
| A0A820ZZM2 | 1-183 | None |
| A0A2Z6AHD0 | 14-252 | None |
| A0A1E3LV73 | 25-253 | None |
| A0A821PQZ5 | 4-302 | None |
| A0A4T0J2J1 | 154-451 | None |
| A0A158R5R4 | 4-289 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.