DPCstruct | MC35127
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 92 ± 12 aa |
| Standard deviation of domain lengths | 11.66 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 87.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 29.37 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G8SEJ8 | 2-100 | SKRTVVIAGITLNVFSLDNRDSEPESTSPKPIAILFLLHGRTSRADHLELMVKAFLDEVSTRRRDPAQAGKEAHDLWVVTFDHRNHG… |
| A0A0B7NTX5 | 1-94 | MASSKQVIPIIGLHITVYGLDEYNQLPKGTPVSIMFALHGRLQNQSKMEPIAQAICQLNEKRKQGDSHILVITFDSANHGSRLVHKL… |
| A0A545VH62 | 13-97 | None |
| A0A1C7M6N0 | 11-86 | None |
| A0A401H203 | 4-78 | None |
| A0A0D0V1P1 | 38-126 | None |
| A0A1Z5ST44 | 40-127 | None |
| A0A5N6K0J4 | 8-99 | None |
| A0A5M9MIF0 | 20-119 | None |
| A0A433PMA4 | 1-117 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.