DPCstruct | MC35126
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 563 ± 45 aa |
| Standard deviation of domain lengths | 44.54 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 70.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.50 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 31.85 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G8SBV8 | 1-600 | MRVHRLRALAVQKLAAAYKADEIASSVMVMQGGSVFDDIAERVLRVDPGDVDARYVHFFHEKIPSRQLAESTSTQVLDDLIAANPHR… |
| A0A0L6X476 | 212-740 | MRIHRLRALAVQKLAQAYKADEIASSVMIMQGGSVFDDVAERVLRHDPTDLDAKYVHFFHEKIPSRQLAESTSTRVLDELIAARPQH… |
| A0A6A5ZTP8 | 590-1120 | None |
| A0A395MZ59 | 655-1204 | None |
| A0A4V2EQR9 | 1-532 | None |
| A0A5C6GEB1 | 350-884 | None |
| A0A067NU93 | 277-838 | None |
| A0A1V8TWP4 | 348-1012 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.