DPCstruct | MC3512
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 106 ± 9 aa |
| Standard deviation of domain lengths | 9.03 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 79.26 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 27.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W5CUV1 | 5-98 | FPIATLAASLIAVVPAVAQTAGYYAATPATAPTKNTLITSGTLWKCADGVCGAAKSTQRDVIMCQMVAQRVGKLNAFSVAGAAFDEA… |
| A0A6I6MXN7 | 2-106 | LRRLLIVAGLIFVAASSADAQTPVARRFIYTAQLNGDALATGQVDAGGIVWQCSGRTCTVTGPWPAPGVPACVALAARVGAIASYGR… |
| A0A1G0HZA2 | 3-124 | None |
| A0A1M3A840 | 36-135 | None |
| A0A2W5A7L3 | 1-92 | None |
| A0A524P6C0 | 1-104 | None |
| A0A831YKD8 | 1-106 | None |
| B4RD42 | 69-176 | None |
| Q9A2V4 | 38-146 | None |
| A0A2D8BVS7 | 1-102 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.