DPCstruct | MC35119
Metacluster Properties and Pfam Annotations
| Number of structural domains | 85 |
|---|---|
| Mean domain length (aa) | 201 ± 37 aa |
| Standard deviation of domain lengths | 36.67 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 80.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.61 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 20.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G8RN41 | 38-210 | AHEIKQVFGQVFAEQDLDPAATGEAEWRERHFDVVDDEVGPLVMWEICELGFRYELYALDRAIRSSALEKERVVLLGRIFPSDSLFS… |
| A0A550BRK5 | 590-775 | PPDGPLAYAMRELQAGFGDGLNLETMSQRLQLPYRVHGTVVAAGAMPPMETLKSILWRLQELGFRKDLLDLDRRVRVCILTAAQESR… |
| A0A6A4HH48 | 393-631 | None |
| A0A6A4HB77 | 605-799 | None |
| A8PHU1 | 690-889 | None |
| A0A0D7B076 | 184-453 | None |
| A0A0D7ATV4 | 206-511 | None |
| A0A0D7ASU6 | 336-568 | None |
| A0A0D7ASH3 | 13-228 | None |
| A0A0D7ARK7 | 34-249 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.