DPCstruct | MC35117
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 92 ± 3 aa |
| Standard deviation of domain lengths | 3.30 |
| Length coefficient of variation | 0.04 |
| Mean AlphaFold2 pLDDT confidence score | 89.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 42.36 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0106 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2H4SCD5 | 502-594 | VEALFPGPYAAYSTRMLSGDYHTRAEPLWAVDLARKDARHAKALAAAAGTRVQNVETADAHLASLREHAGPSGDIAAIYGVVRKEAG… |
| A0A7R7VTD5 | 1-90 | MFGPVLESYLKRITAGAYAPPLHRTPVFAAALADMKHASSIAASHGTHLLTVELALGRLNSAREFAGEYLDSAAVYGTARVEVGLAF… |
| Q6MYF1 | 293-380 | None |
| A0A2I0S4Q1 | 216-309 | None |
| A0A5N6THI3 | 58-148 | None |
| A0A218YZX3 | 5-100 | None |
| A0A5Q3G5V9 | 643-735 | None |
| A0A2H3I5J6 | 430-522 | None |
| A0A364KRF1 | 699-794 | None |
| A0A0K8LKU2 | 1085-1169 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.