DPCstruct | MC3511
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 149 ± 9 aa |
| Standard deviation of domain lengths | 9.20 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 78.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 33.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A231RFL1 | 84-239 | RVRLLEEDIEHAVEQLDRIRKKKETLLQVLSQRFQPEELSYSKFASAIAGAESLFYRNVRSVLNRLQAFDESEFESLGSRRAARMPR… |
| A0A328SR31 | 1-143 | MNSKNNDYTSINQKYIEYERQILKLKKEFSYKKNKAIELIEKRFAPPQITYDKFISTVENVDKVFVSESETALDMLRYSNEYSEDMD… |
| A0A843EZ76 | 195-355 | None |
| A0A315XP84 | 158-302 | None |
| A0A843GQ41 | 50-200 | None |
| A0A328SDB7 | 261-409 | None |
| A0A843F4S3 | 297-436 | None |
| A0A843EVN8 | 123-276 | None |
| D3E385 | 11-150 | None |
| A0A843DND2 | 179-313 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.