DPCstruct | MC35109
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 210 ± 44 aa |
| Standard deviation of domain lengths | 44.05 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 82.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 31.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0K6G763 | 3-192 | LSRSPLYLRHFESPSLISGCIKLMASVQVAGKPSPFNYEYGYLCFKIITLAVGVCLLARRYELAGTISEMIADQDSILLDIFSRRVS… |
| A0A0K6FU28 | 1-249 | MIDAPLNNLWSLPITRYTELYINDAVSMRLAVPSPEMESIGNVIASLGAMHTIPMLANSSLDTNTRESIIAAVTLQDLKNTLELVRL… |
| A0A0K6FXV3 | 4-197 | None |
| X8JDL8 | 1-190 | None |
| X8J068 | 22-201 | None |
| A0A0K6G3N9 | 63-266 | None |
| A0A0K6G1G0 | 1-168 | None |
| A0A0K6FXS0 | 1-285 | None |
| A0A074RQU0 | 3-296 | None |
| A0A074S6F4 | 28-176 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.