DPCstruct | MC35106
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 119 ± 21 aa |
| Standard deviation of domain lengths | 21.16 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 86.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 30.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X7LGX5 | 22-131 | VKKLHRIETRNQWGYWVVELIAWNEKHKAFIAEKSFNSETGRFWYKHKMVRRSFVVIKRALPDMFHYLDNPRIPKSTNGLESFFGHL… |
| A0A1V5WT40 | 13-134 | YLTGKPKLEASIELKAIGDTLTYTTEEEFTTKFTSWCIKWDSFLKERTTDPITGRWCYTHKRVRSARRSVKNNLPCLFTYLKYPELN… |
| A0A381ECL5 | 8-109 | None |
| A0A3D2WW17 | 4-88 | None |
| A0A6A2VGY3 | 200-354 | None |
| A0A381E5M0 | 12-137 | None |
| A0A1X3D2R2 | 3-90 | None |
| A0A0M5M3I3 | 2-142 | None |
| A0A1F1DZJ4 | 8-110 | None |
| A0A087EBI7 | 497-641 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.