DPCstruct | MC3510
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 68 ± 9 aa |
| Standard deviation of domain lengths | 9.45 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 70.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 38.58 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7G1JN45 | 6-72 | ALKCPKCKSIKLQTYVPTQKRYSRKAGMIGHAINGIEGAMFAMLYEADRTYYRCQHCGYRFSRKENR |
| A0A0F4LEZ2 | 153-234 | EKAVKVTSMIGSVINSMRQPHCPKCRSTNVQAVGQHRKGFSVGKAVAGTALSGGLGAIAGFAGKNTKKVDMICMNCGKKFRF |
| A0A1S7DQJ5 | 2-65 | None |
| A0A645AFA6 | 19-83 | None |
| A0A1P9X270 | 3-61 | None |
| A0A7X8Z922 | 73-134 | None |
| A0A358S7E1 | 16-94 | None |
| A0A353J1Z8 | 142-203 | None |
| A0A1G9XR76 | 8-75 | None |
| R4K532 | 114-174 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.