DPCstruct | MC351
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 168 ± 13 aa |
| Standard deviation of domain lengths | 13.34 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 87.80 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 35.07 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Z2C752 | 17-170 | QPPGFRFDPPLTKGSTVKNLSAFHLLQSSLIRSHDSLLCCQLLRTLQTIWEKDPTNFFLLEWTVQTMRQLSACVQQKPASVQKLFFS… |
| A0A1B0D248 | 81-233 | IASLCMCGYTELRPNLNQSGSLFQMQGFTMPQTSSRGTCIRNVHAFQVLQTIFLKSNSTPLCCNILDAISSVYHSDNANYFILESQN… |
| T1GN58 | 75-256 | None |
| H3A743 | 352-537 | None |
| W6V355 | 187-357 | None |
| H3DGI6 | 224-401 | None |
| A0A1I7XJY6 | 113-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.