DPCstruct | MC35091
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 159 ± 36 aa |
| Standard deviation of domain lengths | 36.40 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 86.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 34.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2K5HJC5 | 22-157 | ADRSSRLLESLDQLELEREELNLTANRLMGRTLTVEVSVETIRNPQQQESLKHATRIIDEVVNKFLDDLGNAKSHLMSLYSACSSEV… |
| A0A7R9J3Z0 | 12-122 | GEREEVNHFAEHIFNRCLTVEVHVKTTRDPMQEDSLHQVNSYIDSLVVSLREDPTGTKTRCVMYMNACSSQAQGAADKNFEAVILGC… |
| A0A3P8BI94 | 7-99 | None |
| A0A835NLE6 | 38-219 | None |
| A0A6A4JJK9 | 863-973 | None |
| T1H154 | 136-269 | None |
| M7C5C6 | 3-105 | None |
| A0A5A8EEG5 | 4-237 | None |
| G5ANB8 | 7-99 | None |
| A0A0A9Z481 | 24-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.