DPCstruct | MC35086
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 128 ± 9 aa |
| Standard deviation of domain lengths | 8.63 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 85.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 33.97 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S0HGC9 | 300-420 | IIVGSICVARRDLPRSYIVCDQAYEVKEIYYQGLRGAEVERVPVASLDARRPEGCAGYTLYLKLYSQEYHTEPVTVRPEEVGIVSLG… |
| A0A7S2R9F8 | 1-128 | IVKGCIVIPRVDIPELRIVEAQNYEVVDIYLQGSQENGDTLIERVPLKSLNSNRPPGTESYTIYLKLFNPRYNEEPVICTPEEVGLV… |
| A0A7S0C5F6 | 28-171 | None |
| C1N2Z8 | 158-295 | None |
| A0A7S4A2E2 | 66-183 | None |
| A0A7S1UU88 | 1-123 | None |
| A0A7S1FKY2 | 92-214 | None |
| F0YD39 | 75-192 | None |
| A0A7S2TTY4 | 111-247 | None |
| A0A7S3S6N7 | 86-216 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.