DPCstruct | MC35082
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 180 ± 13 aa |
| Standard deviation of domain lengths | 13.23 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 91.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 35.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3N4SRS1 | 90-270 | EWVLVHHPEDGHHALGVVPDLERAARQAKSRPKAALDAYLELGGRLAASVPHFLPTFYEQAGRVFLAEENPTYAAQLFTRARKAEAE… |
| A0A4R7A1U2 | 5-186 | IAPEAERIARLAKSDARAALDACQDAAERLACAGPHLLPTLHEQTGRVFLAVGKPTYAARMFTLARAAETEHGLTVDEERLEAVCLE… |
| A0A7W7GXQ5 | 78-260 | None |
| A0A7X9VIN9 | 80-260 | None |
| A0A8A9B1M2 | 104-267 | None |
| A0A562II43 | 88-284 | None |
| A0A7W8QKB7 | 1-208 | None |
| A0A2P8DHQ8 | 89-273 | None |
| A0A6B8WBF4 | 70-251 | None |
| L1MFK7 | 77-256 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.