DPCstruct | MC35081
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 81 ± 9 aa |
| Standard deviation of domain lengths | 9.31 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 60.48 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF06333 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2A3EK90 | 124-201 | LHSPAIQQNSDDLLQQQSALTAHPLDSQYTTDVLRYVLEGYNALSWLAVDANTKDRLSCLPVHVQALMQLYHAAAALV |
| A0A069DMM1 | 1-103 | MPRWFWSACPHLETACPAFLKNALHLHSTAIQQNSDELLQQQTVVAGHPLDSQYTTDVLRYVLEGYNALSWLALDSNSHDRLSCLPV… |
| A0A814PNU5 | 292-363 | None |
| A0A084WP71 | 395-471 | None |
| A0A819AAM9 | 312-390 | None |
| A0A7R9PPV9 | 65-142 | None |
| C1L3Y4 | 254-330 | None |
| A0A815QXS7 | 7-78 | None |
| A0A1B0DIX2 | 1-93 | None |
| A0A2G8KL11 | 218-293 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.