DPCstruct | MC35058
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 296 ± 76 aa |
| Standard deviation of domain lengths | 75.71 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 86.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.50 |
| Mean intra-cluster sequence similarity (%) | 18.68 |
| Pfam Score | 94.03 |
| Assigned Pfam label(s) | PF10143- CL0088 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D2CNY1 | 2-370 | KRVFLIVLDSLGIGEEPDARLFGDRDCHTLKRIASAPEFRFESMRRLGMGNIDGQEYLPGEAKPLAAVGRLQECSMGKDTTIGHWEL… |
| A0A3N9V180 | 41-309 | VLGLVRTIPEGMDPGSDVANMAVLGYDPRKYYSGRAPIEAASMGLQLAPEDVAFRCNLVALQDRHDGTYMHDYSAGHITSDESHEII… |
| A0A562C2S2 | 30-234 | None |
| V6LSF4 | 17-313 | None |
| A0A520VR24 | 11-244 | None |
| A0A554X9V7 | 18-285 | None |
| D0KVH8 | 120-411 | None |
| A0A1V9YLA1 | 3-401 | None |
| A0A6L5C520 | 298-590 | None |
| A0A835H800 | 11-311 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.