DPCstruct | MC35057
Metacluster Properties and Pfam Annotations
| Number of structural domains | 44 |
|---|---|
| Mean domain length (aa) | 103 ± 12 aa |
| Standard deviation of domain lengths | 11.77 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 86.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 59.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03759 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J8X730 | 2-106 | MKERFAKLLLGEDMSGGGKGVCTALAISNAITNLSAKWVLFVVTAATVFGELWRLEPLAPQKKEMWKREMEWLLCVSDSIVELVPSI… |
| A0A830C305 | 1-100 | MSGSGKGVCTAVSISNAITNLYASVFGQHQRLEPLHSDKKLMWKREMNCLLSVCDYIVEFSPTLQTLKDGSTLEVMTSRPRSDIYIN… |
| A0A835RGH6 | 101-215 | None |
| A0A5D2TNM5 | 178-292 | None |
| A0A446Q002 | 1-100 | None |
| A0A5P1ET14 | 153-272 | None |
| A0A7G2DX05 | 113-227 | None |
| A0A5N6NCK6 | 386-499 | None |
| A0A565BLK8 | 33-117 | None |
| A0A7N0TGU8 | 1-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.