DPCstruct | MC35054
Metacluster Properties and Pfam Annotations
| Number of structural domains | 63 |
|---|---|
| Mean domain length (aa) | 129 ± 19 aa |
| Standard deviation of domain lengths | 19.07 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.59 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 40.18 |
| Pfam Score | 98.65 |
| Assigned Pfam label(s) | CL0110- CL0270 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2SG19 | 115-259 | KMEIIPNPKEVNGIKVLQLETAAGAAIRFFDHAIGINVPRSRFLPVKATSDLLLVQSDLYTLVDGFVIRNKDRANPTNPSIELGPEF… |
| A0A7J8WKB6 | 20-142 | FENPKFFDRAIGINVPRARYLPLRTTADLFLYPCDIYTLVGYVFNRKSKANSLDPVVEFGSEFFKPTDFLSRFKTMPSIIELDSLKV… |
| A0A7S2I2V0 | 350-459 | None |
| A0A7S4L862 | 493-616 | None |
| A0A3E2CS28 | 7-122 | None |
| A0A3P7DYZ2 | 2-100 | None |
| A0A7C4ABG6 | 129-282 | None |
| A0A2K1IK49 | 351-470 | None |
| A0A0R3T9M6 | 15-145 | None |
| A0A498NFB1 | 677-821 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.