DPCstruct | MC35051
Metacluster Properties and Pfam Annotations
| Number of structural domains | 1138 |
|---|---|
| Mean domain length (aa) | 110 ± 17 aa |
| Standard deviation of domain lengths | 17.04 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 11.57 |
| Pfam Score | 88.52 |
| Assigned Pfam label(s) | CL0322- PF04279- PF04402- CL0063- PF01250 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3B0BY70 | 2-97 | AYYVITRTIIEDQSSKEDVLAMSKESAEIFRKQPGLIEMKSLIAENETHLSTYLVWENQQSHLACMESKDFDGVTVQWTAFMKEGKI… |
| A0A239SML3 | 60-200 | ASEEAYQEHIASQHFQAFAELAKKAVTSREVINLVPEIFLQKPQEMRVFEKNDLSVRLATVRVNDNAAFSDIVLPEMRASMEKESGV… |
| A0A2S1LMG0 | 13-110 | None |
| A0A830Y7U9 | 1-124 | None |
| A0A5N6EJM9 | 490-606 | None |
| A0A1L9TE34 | 493-627 | None |
| G6C4N1 | 19-95 | None |
| A0A1H0T0M8 | 325-439 | None |
| A0A5S6QPP7 | 48-146 | None |
| H0EXA9 | 283-398 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.