DPCstruct | MC35050
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 117 ± 23 aa |
| Standard deviation of domain lengths | 22.80 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 82.74 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 29.68 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L9F0B2 | 1-87 | MKKKYIEPRIYHGGDNYDLSKRWYVYFSYEHPTKLNKDGTPYMKRQTPIALSVNRNFKIKSERFYHLKIIKEVLHEMLKEGYTPYAQ |
| A0A6N8UDU9 | 3-113 | FFNSALENEYKTGTKVKKYTTPKIYKGGKNGTDSWYVYYSYQHPFKKTKTGKPVMQRIKAPTFNLNRKYKSYDKRLIHFTALRDSLE… |
| A0A4R5C562 | 1-93 | None |
| A0A6N4X894 | 1-152 | None |
| A0A1R4KZL1 | 2-143 | None |
| A0A7L4ZSA8 | 16-119 | None |
| A0A2K8XDU8 | 7-110 | None |
| A0A4R6TT58 | 5-128 | None |
| A0A2V4XUW4 | 2-129 | None |
| A0A0C3R513 | 1-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.