DPCstruct | MC3505
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 169 ± 19 aa |
| Standard deviation of domain lengths | 18.54 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 85.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 14.50 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7I8D1M3 | 3-171 | NICIYDFVTKFNKSELRKRMVPQEVVSGWPCIQKVGKTLCITIPYYSRLLGREKTALYPLFCSVTLPLGNPDRVLDFTIYPYQKEWR… |
| A0A7S6M5A5 | 84-258 | MPIAPGRFAAKELFQLARMNASGAVPDESRQSLPIPIRTREGMRVQFIFFAAVPRPNVQMLGVPQYLATLDPRNGALELLRKVTPSD… |
| A0A1C6GGJ7 | 131-286 | None |
| B4VV93 | 16-194 | None |
| A0A4Q1RD70 | 3-146 | None |
| A0A4P2QXN8 | 3-178 | None |
| A0A416CEM7 | 289-425 | None |
| A0A3B9YIN0 | 25-198 | None |
| A0A7W0VAC7 | 27-193 | None |
| A0A6M3ZLR6 | 15-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.