DPCstruct | MC35047
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 71 ± 5 aa |
| Standard deviation of domain lengths | 4.92 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 94.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 45.06 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K0ZMR1 | 3-66 | QNFVLKHIMPSKFSKKERPILINNWEATYFDFQREKLLELADEAKKVGIELFVLDDGWFGNRFD |
| A0A174GPH2 | 1-77 | MTYSAEGFGKLSRNYHDAYRSNLIRSKYVDQPRPVLVNNWEATYFDFDADKLYHIAEEAKNIGLDMFVLDDGWFGKR |
| A0A1H0CL23 | 154-220 | None |
| A0A2N6NCM4 | 9-83 | None |
| A0A660SQS9 | 9-85 | None |
| A0A8B3HH69 | 1-65 | None |
| A0A0D7X096 | 1-66 | None |
| A0A847CCM0 | 194-263 | None |
| A0A7U9XJQ1 | 159-237 | None |
| A0A378MDG5 | 67-137 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.