DPCstruct | MC3504
Metacluster Properties and Pfam Annotations
| Number of structural domains | 61 |
|---|---|
| Mean domain length (aa) | 67 ± 8 aa |
| Standard deviation of domain lengths | 7.99 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.21 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 46.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0220 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S6S0G4 | 378-448 | TPLTPGDLDGDGRLTNFDIDPFVLALTNREAYQAAFPHIPPEAIDILGDLNGDGVLTNFDIDPFVEALVNG |
| A0A7S6M550 | 375-446 | APAIVAAPVRGDANCDGVFNNFDIDPFILRLTNPAAYAAAYPGCPAATTDINGDGVVNNFDIDPFVNCVTSG |
| A0A5C5VPC8 | 536-597 | None |
| A0A842WUJ3 | 31-100 | None |
| A0A3A0CSY4 | 452-518 | None |
| A0A3A0CNP6 | 573-636 | None |
| A0A518HN44 | 145-237 | None |
| A0A7S6S0P6 | 74-141 | None |
| A0A518LIQ0 | 160-223 | None |
| A0A7C4C851 | 1031-1096 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.