DPCstruct | MC35038
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 73 ± 5 aa |
| Standard deviation of domain lengths | 5.47 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 87.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 56.79 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E9IH10 | 1-76 | WTWNSSNWAYNEDEEPIICGNVTGARHCNENFTCLSVGPNPNHGYTNFDNFLWSMLTTFQLITLDYWEDVYNKVAV |
| A0A3Q7RHK3 | 3-69 | YFYYLEGSKDALLCGSSTDSGQCPEGYKCVKAGRNPDYGYTSFDTFSWAFLALFRLMTQDYWENLYQ |
| A0A4C1SSZ2 | 13-95 | None |
| A0A6J1TP56 | 1-74 | None |
| A0A818JWS4 | 247-312 | None |
| A0A6P7FZE3 | 3-78 | None |
| A0A821FXD0 | 2-67 | None |
| A0A7R9J8D7 | 1-74 | None |
| A0A7E4RQN9 | 115-191 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.