DPCstruct | MC35036
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 356 ± 30 aa |
| Standard deviation of domain lengths | 30.21 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 70.01 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 33.53 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E9IF47 | 1-374 | MLQPSQVISESARQAERLKQQRYEKQLDFQRQYEYLIVEATERIRKERSAIMEENIRNEIRNWIDTYFQQTGKIPDLPSAESGGSRM… |
| A0A0J7KWE3 | 191-561 | MLQPSQTITESARRAERLKQQRYEKQLDFLQQYQDLILEAKERIRNEMSAVMEENIRSEIRNWIDTYFQQTGKIPDLPAAESGGSRM… |
| A0A3P6TUI0 | 84-422 | None |
| A0A5K3F269 | 148-517 | None |
| L5K3U9 | 260-641 | None |
| A0A2C9K6B4 | 269-642 | None |
| A0A484AU54 | 1-279 | None |
| D8RSC0 | 2-335 | None |
| A0A1B0CRU6 | 666-1022 | None |
| A0A091DJZ8 | 387-768 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.