DPCstruct | MC35035
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 108 ± 8 aa |
| Standard deviation of domain lengths | 8.11 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 88.61 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.95 |
| Mean intra-cluster local Distance Difference Test score | 0.92 |
| Mean intra-cluster sequence similarity (%) | 46.37 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0323 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W1BJ46 | 121-223 | LSPVLFEETARLIHSNAITIEIAPHGLLQAILRRSLKKDVINIALTQRNHKDNVQVLFTAFGKLYESGLNPHLANIYPHVPFPVSQG… |
| E2ABR5 | 168-272 | LTPVVFSEAMHFIPNDAVTIEIAPHDILQYILNDSLKATVTNVALYKFSHKPNVEIFLPGIGKHYNAGLQLQIANLYPEIKFSVSRN… |
| A0A7R9JLU0 | 1-114 | None |
| A0A6V7YC02 | 98-201 | None |
| A0A834XP43 | 160-269 | None |
| A0A6J1QE43 | 117-221 | None |
| A0A6P3XG71 | 77-177 | None |
| A0A4C1WNU1 | 259-356 | None |
| A0A4Y2KIZ0 | 1-115 | None |
| A0A7R9F1R6 | 108-234 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.