DPCstruct | MC35034
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 66 ± 3 aa |
| Standard deviation of domain lengths | 3.22 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 72.64 |
| Mean fraction of residues predicted as intrinsically disordered | 0.44 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 46.08 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0023 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| E9IEN6 | 1-63 | MLRVSPGDGGSFFNADKRKKQVTLVDPASGQSSSAEDRRPTVAAPKMFAFDAIFTEEDSQVSR |
| A0A4Z2BV46 | 239-304 | KVMMRICPSLETNDSSESQSFLKVDSRKKQLTLYDPASSPHSGSGHRRSATVAVPKIFAFDAVFTQ |
| A0A4Y2PI34 | 68-140 | None |
| A0A7E4S558 | 1-67 | None |
| G1NYC6 | 301-364 | None |
| A0A484CA22 | 62-130 | None |
| A0A1I8NK50 | 61-127 | None |
| A0A2B4S3D3 | 272-331 | None |
| A0A482WT85 | 77-140 | None |
| A0A6B0RB25 | 285-350 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.