DPCstruct | MC35032
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 51 ± 3 aa |
| Standard deviation of domain lengths | 2.80 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 88.23 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.96 |
| Mean intra-cluster local Distance Difference Test score | 0.97 |
| Mean intra-cluster sequence similarity (%) | 93.09 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16422 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T1EJB1 | 78-129 | STKQVIVFEGQDKNPEMCRVLLTHEIMCSRCCDKKSCGNRNETPSDPVIIDR |
| E9I994 | 1-48 | AIMYEGQDKNPEMCRVLLTHEVMCSRCCDKKSCGNRNETPSDPVIIDR |
| A0A5K3FM96 | 260-311 | None |
| A0A7R9QLL3 | 238-292 | None |
| A0A183QP71 | 433-487 | None |
| A0A643C4W4 | 230-280 | None |
| A0A194PSR7 | 259-305 | None |
| A0A182E3F8 | 171-219 | None |
| A0A4U1ELB3 | 187-231 | None |
| A0A0L8G883 | 303-350 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.