DPCstruct | MC35028
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 190 ± 22 aa |
| Standard deviation of domain lengths | 21.61 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 83.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 32.71 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2J0M7C6 | 12-192 | TRAQVAQSAGKSIDATLETKYDSDIVARVVASQTSVATEVREKILTFVTYGTQTTEALGAGERGGVVNSFKEAFGKLPESESDWEDV… |
| A0A1F5SUJ5 | 372-561 | GGADNSRPLITERKNSENTELKPEVLGVKIGDSSATQFSQIAVEAGDLAGGKVRNFVAEGTKSTAKLGAGERAGVLNSYKSSFGKSP… |
| A0A1V5XV14 | 1094-1267 | None |
| A0A3D0YWC7 | 330-496 | None |
| A0A1F5SML1 | 916-1096 | None |
| A0A2N6A9L2 | 211-439 | None |
| A0A1F4RLH2 | 904-1094 | None |
| A0A0G1HT67 | 8-184 | None |
| A0A1F5SZG1 | 511-717 | None |
| A0A1L9GTP5 | 1005-1223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.