DPCstruct | MC35024
Metacluster Properties and Pfam Annotations
| Number of structural domains | 58 |
|---|---|
| Mean domain length (aa) | 73 ± 7 aa |
| Standard deviation of domain lengths | 6.65 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 92.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 41.10 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0098 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2T2U958 | 1-77 | MRIDVVTALPGLVEGPLRHSILKRAAQKGLADVRVHDLRDYGAGKHREIDDYPYGGGAGMVLKPEPIFACIEDIKEN |
| A0A6L8Q5I3 | 1-78 | MLIETLSTFPHMYDSVMGESMMKRAQEKGILEFRAHDLRDWTHDRHRTTDDDPYGGGAGLVMKCDPIFEAVEAILGKE |
| A0A4Q4D2R3 | 1-71 | None |
| A0A2M7WZL0 | 1-74 | None |
| A0A4Q4Z9K8 | 1-71 | None |
| A0A0G0N3U0 | 1-75 | None |
| W4QAY5 | 1-69 | None |
| H1LGB7 | 1-58 | None |
| A0A239QQG9 | 4-78 | None |
| R6Y4T6 | 1-66 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.