DPCstruct | MC3502
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 73 ± 9 aa |
| Standard deviation of domain lengths | 8.54 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 84.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 42.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4Y2K7T1 | 46-113 | MATRGCSNDHNKFCYICGELTMKKQQRNITDFVKKLYFDYFGVKLGDQDKSCVPHIVCCIRVEELKQW |
| A0A4Y2QAA7 | 5-81 | SRRCCENDPNSFCYTCGEYMLKKQRNTITSFVKKAYFWYFGMKLGDQDKYWAPHFTCRSCVEKLRNWTLGKSLSLPF |
| A0A4Y2NJR7 | 1-74 | None |
| A0A4Y2BMT9 | 1-70 | None |
| A0A4C1UX50 | 77-139 | None |
| A0A4Y2BCJ8 | 149-208 | None |
| A0A0V0TNI0 | 1-69 | None |
| A0A4Y2A4N0 | 2-78 | None |
| A0A4Y2PWK8 | 1-78 | None |
| A0A4Y2ILS8 | 3-71 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.