DPCstruct | MC35015
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 290 ± 39 aa |
| Standard deviation of domain lengths | 38.57 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.79 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 47.15 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08083 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D6LLL6 | 1-285 | MRSGRTRRAEDIPLVSEWYKEHCPPAYPVKVRVSYQKLLKCYVLNELHHRPPKAQKKKHLFRSLQATKFFQTTELDWAEAGLQVCKQ… |
| A0A0C9YRZ3 | 2-340 | MPKNVPLVLHEDVIFRPNDVDKDEFELPGDVEPFLAGQPSQNDLAADGIGLWRVPDPYSCCSRWTRCTQDIPLVKNWYLEHCPPDQT… |
| A0A2S4URD0 | 70-382 | None |
| A0A072VVA3 | 1-241 | None |
| S9UW48 | 439-766 | None |
| A0A7J7IFK1 | 44-306 | None |
| A0A2S4VAW8 | 226-498 | None |
| A0A4S8M920 | 71-377 | None |
| A0A2P8XJN9 | 5-261 | None |
| V6TNG2 | 180-499 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.