DPCstruct | MC35012
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 156 ± 16 aa |
| Standard deviation of domain lengths | 15.77 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 68.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.45 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 21.43 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04468 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| F4RFG1 | 972-1161 | PATAPTFYPNSAFHPQATSSPLLGPSGNGTFGAIYSASTPGPGPHELGELGKGVPLHSLSKNCKLYIVEFKGARKDLFYFIMGDGME… |
| A0A0C9YMH3 | 1-157 | MGHLIQPQQGLFYPQQMQHHSSNAPVLNLNDLGKGVPLSSVLALWPLYIVKFKASRTDLFYLTNLSLDIWVGDLVIVEADRGKDLGT… |
| A0A1Y2GNG0 | 1-178 | None |
| A0A3F2RGI0 | 256-388 | None |
| A0A1G0RH63 | 78-220 | None |
| A0A0L0RWI0 | 239-395 | None |
| A0A1J4JKH3 | 73-218 | None |
| A0A7J6Z4G4 | 100-238 | None |
| A0A7T9KCN7 | 233-395 | None |
| A0A1J4L0D7 | 122-266 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.