DPCstruct | MC35011
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 130 ± 17 aa |
| Standard deviation of domain lengths | 16.67 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 81.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 30.80 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0C9YM10 | 4-137 | CYKLFCEQFPDMYKQILAMYKDTVVLGKADKTVAQHQHLFHNTSKRLVQLFNSVAKCHAFEGAFLLAGSVVNQDGDLGYMHMTPGAE… |
| A0A4Y7RJV5 | 173-280 | YQAYIARHPTNFQSLLETFAETCDIEKLFGTTVGQRKAEFKKFTTIVSTLCERFYKRQGFEVAVMGVGNIVNADGNLQFCYETPGVE… |
| A0A2R6NWM4 | 556-669 | None |
| F8PZD4 | 89-228 | None |
| F8PI09 | 33-177 | None |
| F8NZ09 | 63-189 | None |
| S7R6M1 | 123-257 | None |
| A0A0C9YG41 | 64-176 | None |
| A0A0C9XUH3 | 3-125 | None |
| A0A165Z1R0 | 252-384 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.